Return to main results Retrieve Phyre Job Id

Job DescriptionP0A817
Confidence9.23%DateThu Jan 5 11:06:38 GMT 2012
Rank75Aligned Residues47
% Identity26%Templatec2btwA_
PDB info PDB header:transferaseChain: A: PDB Molecule:alr0975 protein; PDBTitle: crystal structure of alr0975
Resolution2.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   186...190.........200.........210.........220.........230.........240.........250.........260....
Predicted Secondary structure 










































Query SS confidence 














































































Query Sequence  LSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFS
Query Conservation 

 

   
        
 
 

  
     
   
   




 





 

 













   






Alig confidence 





















..................






..............

















Template Conservation 
        
 
 

  
   
..................      
..............



 
  


 





Template Sequence  VKVNHASDTNIEDFRKQVAENL. . . . . . . . . . . . . . . . . . KQDGNFV. . . . . . . . . . . . . . IVNYLRKEIGQERGGHIS
Template Known Secondary structure  GGGS
T..................TSTT
..............GGGGTSSSS
Template Predicted Secondary structure 




..................




..............











Template SS confidence 














































































   139140.........150.........160 ....... ..170.........180.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions