Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9L3
Confidence12.76%DateThu Jan 5 11:10:37 GMT 2012
Rank67Aligned Residues36
% Identity17%Templatec3k7cC_
PDB info PDB header:protein bindingChain: C: PDB Molecule:putative ntf2-like transpeptidase; PDBTitle: crystal structure of putative ntf2-like transpeptidase (np_281412.1)2 from campylobacter jejuni at 2.00 a resolution
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   119120.........130.........140.........150.........160.........170.....
Predicted Secondary structure 


























Query SS confidence 
























































Query Sequence  RTDRVRVHYTGKLIDGTVFDSSVARGEPAEFPVNGVIPGWIEALTLMPVGSKWELTI
Query Conservation   

 
 
 
 
 
 

 




     
    
  

 
  
 
  

 
 
    
Alig confidence 





















.....................













Template Conservation 
   
 
   
  


      .....................
 


 





 
Template Sequence  NKDSAKIRVLVLFNNDNNQSSN. . . . . . . . . . . . . . . . . . . . . VFLAKKDRKWLVLL
Template Known Secondary structure 
SSTTS
.....................TT
Template Predicted Secondary structure 











.....................


Template SS confidence 
























































   77..80.........90........ .100.........110..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions