Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9L3
Confidence6.63%DateThu Jan 5 11:10:37 GMT 2012
Rank81Aligned Residues34
% Identity15%Templatec3bboQ_
PDB info PDB header:ribosomeChain: Q: PDB Molecule:ribosomal protein l18; PDBTitle: homology model for the spinach chloroplast 50s subunit2 fitted to 9.4a cryo-em map of the 70s chlororibosome
Resolution9.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.... .....40.....
Predicted Secondary structure 






...........
Query SS confidence 






















. . . . . . . . . . .










Query Sequence  QASYGIGLQVGQQLSESGLEGLL. . . . . . . . . . . PEALVAGIADA
Query Conservation 
 


 
   
  
        
...........      
  
 
Alig confidence 






















...........










Template Conservation   

  

 


 

   

  




 
  




 
 
   

 
Template Sequence  EVAKKVGEVIASACLEKGITKVAFDRGGYPYHGRVKALADAAREK
Template Known Secondary structure  SSSTSS






SSS
SSSTTTTT
Template Predicted Secondary structure 










Template SS confidence 












































   113......120.........130.........140.........150.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions