Return to main results Retrieve Phyre Job Id

Job DescriptionP10030
Confidence6.33%DateThu Jan 5 11:31:59 GMT 2012
Rank63Aligned Residues28
% Identity32%Templated1t3ta1
SCOP infoRuvA C-terminal domain-like FGAM synthase PurL, linker domain FGAM synthase PurL, linker domain
Resolution1.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   132.......140.........150.........160......
Predicted Secondary structure 








Query SS confidence 


































Query Sequence  YLKGIFRLAGKNWTEEFEAFRAALRPVVDQMYAEH
Query Conservation 

   
   


  

   
 
     

   

 
Alig confidence 











.







......







Template Conservation   
   
  


 .

  

  ......    



Template Sequence  YLQEAFTKLGRN. PNDIELYM. . . . . . FAQANSEH
Template Known Secondary structure  TS
.
B......TS
Template Predicted Secondary structure 


.

......

Template SS confidence 


































   189190.........200 ........ .210......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions