Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD19
Confidence1.74%DateThu Jan 5 11:19:42 GMT 2012
Rank65Aligned Residues17
% Identity18%Templatec3hfdA_
PDB info PDB header:chaperone, protein transportChain: A: PDB Molecule:nucleosome assembly protein 1; PDBTitle: nucleosome assembly protein 1 from plasmodium knowlesi
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   76...80..... ....90..
Predicted Secondary structure  ..............
Query SS confidence 









. . . . . . . . . . . . . .






Query Sequence  PLYEQLHQIR. . . . . . . . . . . . . . ARWKSII
Query Conservation 


     
 ..............     
 
Alig confidence 









..............






Template Conservation 

   
 


 
          

 

  

Template Sequence  PIYDKRREALVGNGEAKIGTPNLPEFWLRAL
Template Known Secondary structure  T

S

SSSSTTSTT
Template Predicted Secondary structure 













Template SS confidence 






























   77..80.........90.........100.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions