Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD19
Confidence1.91%DateThu Jan 5 11:19:42 GMT 2012
Rank57Aligned Residues25
% Identity32%Templatec1zi7C_
PDB info PDB header:lipid binding proteinChain: C: PDB Molecule:kes1 protein; PDBTitle: structure of truncated yeast oxysterol binding protein osh4
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.... .....30.....
Predicted Secondary structure  .........




Query SS confidence 














. . . . . . . . .










Query Sequence  PLTLIVFFAARKLAA. . . . . . . . . RYKFPLLNPLL
Query Conservation   


  
     
  .........
       
 
Alig confidence 














.........




.




Template Conservation 

 
    

                


.




Template Sequence  MLAVTKWFISTLKSQYCSRNESLGSEKKP. LNPFL
Template Known Secondary structure  STT
SSTT

.


T
Template Predicted Secondary structure 















.




Template SS confidence 


































   82.......90.........100.........110 .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions