Return to main results Retrieve Phyre Job Id

Job DescriptionP77378
Confidence20.58%DateThu Jan 5 12:28:21 GMT 2012
Rank177Aligned Residues38
% Identity18%Templatec2k1hA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein ser13; PDBTitle: solution nmr structure of ser13 from staphylococcus epidermidis.2 northeast structural genomics consortium target ser13
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   263......270.........280.........290.........300.........310..
Predicted Secondary structure 
















Query SS confidence 

















































Query Sequence  QIQHMVGGNGAKVIVAINKDKNAPIFNYADYGLVGDIYKVVPALISQLSR
Query Conservation 
 

  

  
  




 
  



  

 


 
   


 
 
 
 
Alig confidence 






















............














Template Conservation   
 

  

   






    ............

  
 
 
      
Template Sequence  EIEGVKSIFYVLDFISIDKEDNA. . . . . . . . . . . . NWNELLPQIENTFAK
Template Known Secondary structure  TSTTTT
TT
............
Template Predicted Secondary structure 










............
Template SS confidence 

















































   47..50.........60......... 70.........80....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions