Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAA1
Confidence1.49%DateThu Jan 5 11:12:19 GMT 2012
Rank91Aligned Residues20
% Identity25%Templatec2uwqA_
PDB info PDB header:apoptosisChain: A: PDB Molecule:apoptosis-stimulating of p53 protein 2; PDBTitle: solution structure of aspp2 n-terminus
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60.........70.........80..
Predicted Secondary structure 



















Query SS confidence 
















































Query Sequence  GAEVPLPPRSPVDMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWL
Query Conservation 
 
  






                      
    

  

  
 
Alig confidence 









.............................









Template Conservation    

 
   
............................. 

  
  

Template Sequence  GSERPVADNE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . RMFDVLQRFG
Template Known Secondary structure  T
TT
.............................B
Template Predicted Secondary structure 







.............................

Template SS confidence 
















































   51........60 .........70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions