Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAA1
Confidence3.00%DateThu Jan 5 11:12:19 GMT 2012
Rank38Aligned Residues25
% Identity16%Templatec1llcA_
PDB info PDB header:oxidoreductase(choh(d)-nad(a))Chain: A: PDB Molecule:l-lactate dehydrogenase; PDBTitle: structure determination of the allosteric l-lactate dehydrogenase from2 lactobacillus casei at 3.0 angstroms resolution
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30....
Predicted Secondary structure 



Query SS confidence 





























Query Sequence  EQTPPNRRRYGLAAFIGLIAGVVSAFVKWG
Query Conservation    
   

    
  

 


 

  

 
Alig confidence 









...



..










Template Conservation          

... 


..

 

   
  
Template Sequence  SITDKDHQKV. . . ILVG. . DGAVGSSYAFA
Template Known Secondary structure 
S



S

...S
..TT
Template Predicted Secondary structure 







...
..

Template SS confidence 





























   14.....20... .... ..30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions