Return to main results Retrieve Phyre Job Id

Job DescriptionP17846
Confidence26.61%DateThu Jan 5 11:36:18 GMT 2012
Rank65Aligned Residues41
% Identity17%Templated2o8ra1
SCOP infoSpectrin repeat-like PPK N-terminal domain-like PPK N-terminal domain-like
Resolution2.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   51........60.........70.........80.........90.........100.....
Predicted Secondary structure 



















Query SS confidence 






















































Query Sequence  LIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPGGVITTKQWQAIDKFAGE
Query Conservation   

  
 
 
   
               









 

  

  

 

  
Alig confidence 










..............





























Template Conservation 






 


..............




 



 
        
  
      
Template Sequence  RIKFLSIFSSN. . . . . . . . . . . . . . LEEFYTVRVAYHQAVLQKHILQAIRETVIR
Template Known Secondary structure  ..............TT

Template Predicted Secondary structure  ..............
Template SS confidence 






















































   36...40...... ...50.........60.........70......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions