Return to main results Retrieve Phyre Job Id

Job DescriptionP33666
Confidence21.54%DateWed Jan 25 15:20:50 GMT 2012
Rank119Aligned Residues36
% Identity31%Templatec2b99A_
PDB info PDB header:transferaseChain: A: PDB Molecule:riboflavin synthase; PDBTitle: crystal structure of an archaeal pentameric riboflavin2 synthase complex with a substrate analog inhibitor
Resolution2.22 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.........60.........70..
Predicted Secondary structure 



























Query SS confidence 
















































Query Sequence  ITEVETTTGEKKNTNVTCPADPGKLSPEELKRLPSECSPLVEQNLMPWL
Query Conservation                                                   
Alig confidence 











.............























Template Conservation 



 




  .............  


  

  


 




  

Template Sequence  IIEVFVHEDEAK. . . . . . . . . . . . . DDKELDWLAKRRAEEHAENVYYLL
Template Known Secondary structure 

GGGSS.............S
Template Predicted Secondary structure 




.............
Template SS confidence 
















































   95....100...... ...110.........120.........130
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions