Return to main results Retrieve Phyre Job Id

Job DescriptionP33666
Confidence28.13%DateWed Jan 25 15:20:50 GMT 2012
Rank75Aligned Residues34
% Identity29%Templatec1tkeA_
PDB info PDB header:ligaseChain: A: PDB Molecule:threonyl-trna synthetase; PDBTitle: crystal structure of the editing domain of threonyl-trna2 synthetase complexed with serine
Resolution1.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........60........
Predicted Secondary structure 






























Query SS confidence 



















































Query Sequence  GQGWAADITEVETTTGEKKNTNVTCPADPGKLSPEELKRLPSECSPLVEQNL
Query Conservation                                                      
Alig confidence 







..................

























Template Conservation    
 
 
 ..................     

 
 
  

  
  

    
Template Sequence  DNGFYYDV. . . . . . . . . . . . . . . . . . DLDRTLTQEDVEALEKRMHELAEKNY
Template Known Secondary structure  TT..................
SS


TT

Template Predicted Secondary structure 


..................








Template SS confidence 



















































   99100...... ...110.........120.........130..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions