Return to main results Retrieve Phyre Job Id

Job DescriptionQ57261
Confidence14.31%DateThu Jan 5 12:37:16 GMT 2012
Rank77Aligned Residues41
% Identity27%Templatec3h92A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized atp-binding protein mjecl15; PDBTitle: the crystal structure of one domain of the protein with unknown2 function from methanocaldococcus jannaschii
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   166...170.........180... ......190....... ..200.. ....
Predicted Secondary structure 






....



..............
Query SS confidence 

















. . . .













. . . . . . . . . . . . .




.



Query Sequence  GIGGSNLQGAQRWAQTNT. . . . PVRDRNKRSFWLSA. . . . . . . . . . . . . ARSAL. FNQI
Query Conservation 
    

  
  
     ....   

 

  

 
.............




.

  
Alig confidence 

















....













.............




.



Template Conservation 

    

 










    
   
  














 











Template Sequence  GINYDEVLEALKLFKDNYELPKSKIKRKIRIFLIKENILFLNPQKGTLKPQSYLVWNAI
Template Known Secondary structure  TS

SSGGGS
TTSTTTTSS
Template Predicted Secondary structure 















Template SS confidence 


























































   30.........40.........50.........60.........70.........80........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions