Return to main results Retrieve Phyre Job Id

Job DescriptionQ46907
Confidence21.48%DateThu Jan 5 12:35:45 GMT 2012
Rank117Aligned Residues21
% Identity29%Templatec3imkA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:putative molybdenum carrier protein; PDBTitle: crystal structure of putative molybdenum carrier protein (yp_461806.1)2 from syntrophus aciditrophicus sb at 1.45 a resolution
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   193......200.... .....210...
Predicted Secondary structure 



.........




Query SS confidence 











. . . . . . . . .








Query Sequence  GAEVGYSRARVM. . . . . . . . . NGGVDAEKV
Query Conservation 




 


 

......... 

 
   
Alig confidence 











.........








Template Conservation 











 
    
  




 

 
Template Sequence  GGQTGADRAALDFAIKHHIPYGGWVPKGRL
Template Known Secondary structure 


TTTT



GGG
Template Predicted Secondary structure 
















Template SS confidence 





























   13......20.........30.........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions