Return to main results Retrieve Phyre Job Id

Job DescriptionP76308
Confidence4.18%DateWed Jan 25 15:21:07 GMT 2012
Rank30Aligned Residues26
% Identity35%Templated1ozza_
SCOP infoKnottins (small inhibitors, toxins, lectins) Scorpion toxin-like Insect defensins
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   58.60.........70.........80.........90.
Predicted Secondary structure 

















Query SS confidence 

































Query Sequence  DRACQQEGYTHAVPFGQPVGNCSLFAGSLCLNTE
Query Conservation    

  


  

 

    

    
  

   
Alig confidence 










........














Template Conservation 










........





 







Template Sequence  NAECKRRGYKG. . . . . . . . GHCGSFANVNCWCET
Template Known Secondary structure  TSS........SGGG

Template Predicted Secondary structure 





........










Template SS confidence 

































   1920......... 30.........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions