Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8J2
Confidence24.99%DateThu Jan 5 11:07:58 GMT 2012
Rank1Aligned Residues35
% Identity23%Templatec3bjqA_
PDB info PDB header:viral proteinChain: A: PDB Molecule:phage-related protein; PDBTitle: crystal structure of a phage-related protein (bb3626) from bordetella2 bronchiseptica rb50 at 2.05 a resolution
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10...... ...20.........30.........40.........50........
Predicted Secondary structure 
..













Query SS confidence 






. .









































Query Sequence  VVGIDAL. . VHDHQTVLAKAEGGVVAVFANNAPAFYAVTPARLAELLALEE
Query Conservation         ..      
          
     
  
 

   
  
   
 
Alig confidence 






..













..............













Template Conservation 


  
  


 

 





  ..............

   




 

 
Template Sequence  XLSRKALSACKYHPKLIERVKYT. . . . . . . . . . . . . . ITIDXLKALWEVEE
Template Known Secondary structure 
T
..............

T
S
Template Predicted Secondary structure 




..............




Template SS confidence 


















































   180.........190.........200.. .......210......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions