Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8J2
Confidence20.41%DateThu Jan 5 11:07:58 GMT 2012
Rank2Aligned Residues38
% Identity26%Templatec2e52A_
PDB info PDB header:hydrolase/dnaChain: A: PDB Molecule:type ii restriction enzyme hindiii; PDBTitle: crystal structural analysis of hindiii restriction endonuclease in2 complex with cognate dna at 2.0 angstrom resolution
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   123......130.... .....140........ .150.........160
Predicted Secondary structure 



..



.............




Query SS confidence 











. .













. . . . . . . . . . . . .











Query Sequence  SFIAYWQAEGKV. . FHHVQWQQKLARSL. . . . . . . . . . . . . QIGRASNGGLPK
Query Conservation 


 

 




..


 









.............

 
 
     
Alig confidence 











..













.............











Template Conservation 
  


  

     
     

     
   




       








Template Sequence  DFNKYFMDLFKIDKDTLNQLLQKEINFIEERSLIEKEYWKKQINIIKNFTREE
Template Known Secondary structure  T

T

Template Predicted Secondary structure 


Template SS confidence 




















































   214.....220.........230.........240.........250.........260......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions