Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAU7
Confidence1.97%DateThu Jan 5 11:13:52 GMT 2012
Rank91Aligned Residues25
% Identity20%Templated5pnta_
SCOP infoPhosphotyrosine protein phosphatases I-like Phosphotyrosine protein phosphatases I Low-molecular-weight phosphotyrosine protein phosphatases
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   73......80......... 90.......
Predicted Secondary structure 


........



Query SS confidence 
















. . . . . . . .







Query Sequence  NMSRSELIEEMLMQQLA. . . . . . . . ALRSQGIV
Query Conservation    






  
  

 ........   

 
 
Alig confidence 
















........







Template Conservation 
 








         
     
 



 
Template Sequence  NICRSPIAEAVFRKLVTDQNISENWRVDSAATS
Template Known Secondary structure  SSSSTT
GGGSS
Template Predicted Secondary structure 












Template SS confidence 
































   15....20.........30.........40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions