Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAU7
Confidence2.00%DateThu Jan 5 11:13:52 GMT 2012
Rank90Aligned Residues24
% Identity33%Templatec3rofA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:low molecular weight protein-tyrosine-phosphatase ptpa; PDBTitle: crystal structure of the s. aureus protein tyrosine phosphatase ptpa
Resolution1.03 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   73......80......... 90......
Predicted Secondary structure 


.......


Query SS confidence 
















. . . . . . .






Query Sequence  NMSRSELIEEMLMQQLA. . . . . . . ALRSQGI
Query Conservation    






  
  

 .......   

 
Alig confidence 
















.......






Template Conservation 
 









       
     
 


 
Template Sequence  NICRSPMAEAIMRQRLKDRNIHDIKVHSRGT
Template Known Secondary structure  SSSTT

ST
Template Predicted Secondary structure 









Template SS confidence 






























   11........20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions