Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAU7
Confidence2.23%DateThu Jan 5 11:13:52 GMT 2012
Rank84Aligned Residues24
% Identity25%Templatec3jviA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:protein tyrosine phosphatase; PDBTitle: product state mimic crystal structure of protein tyrosine phosphatase2 from entamoeba histolytica
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   73......80.........90 ......
Predicted Secondary structure 


........


Query SS confidence 

















. . . . . . . .





Query Sequence  NMSRSELIEEMLMQQLAA. . . . . . . . LRSQGI
Query Conservation    






  
  

  ........  

 
Alig confidence 

















........





Template Conservation 
 








         
     
 


 
Template Sequence  NICRSPAAEAVMKKVIQNHHLTEKYICDSAGT
Template Known Secondary structure  SSSTT
GGGS
Template Predicted Secondary structure 










Template SS confidence 































   10.........20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions