Return to main results Retrieve Phyre Job Id

Job DescriptionP37001
Confidence5.59%DateThu Jan 5 11:54:10 GMT 2012
Rank46Aligned Residues42
% Identity26%Templatec2bviK_
PDB info PDB header:virusChain: K: PDB Molecule:hexon protein; PDBTitle: the quasi-atomic model of human adenovirus type 52 capsid (part 2)
Resolution10.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   112.......120.........130......... 140.........150.........160.........
Predicted Secondary structure 









.














Query SS confidence 



























.





























Query Sequence  YGWESTWRPLADENFHLGLGFTAGVTAR. DNWNYIPLPVLLPLASVGYGPVTFQMTYIP
Query Conservation 

 

 
          




  



.
   


 
  





 




   



Alig confidence 



..

..

















.

............















Template Conservation 



..
 ..



 















............
 
 
  
 


 


Template Sequence  YTYE. . WN. . FRKDVNMVLQSSLGNDLRVDG. . . . . . . . . . . . ASIKFDSICLYATFFP
Template Known Secondary structure  ....

SS


TTTTT............



Template Predicted Secondary structure  ....












............


Template SS confidence 


























































   578.580. .. ......590.........600.... .....610.........620
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions