Return to main results Retrieve Phyre Job Id

Job DescriptionP60782
Confidence12.56%DateThu Jan 5 12:07:10 GMT 2012
Rank3Aligned Residues39
% Identity10%Templatec2kncA_
PDB info PDB header:cell adhesionChain: A: PDB Molecule:integrin alpha-iib; PDBTitle: platelet integrin alfaiib-beta3 transmembrane-cytoplasmic2 heterocomplex
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   152.......160.........170.........180.........190.........200.....
Predicted Secondary structure 










Query SS confidence 





















































Query Sequence  PFYVWWFKPQFTFPVSMLSCLILLRHHDNIQRLWRRQETKIWTKFKRKREKDPE
Query Conservation                   
  


 

  

 

  
 
 
             
Alig confidence 























...............














Template Conservation 
 



 
   




  
   
 ...............
 




 

   

Template Sequence  PIWWVLVGVLGGLLLLTILVLAMW. . . . . . . . . . . . . . . KVGFFKRNRPPLEED
Template Known Secondary structure 
...............TTTT

S



Template Predicted Secondary structure 
...............






Template SS confidence 





















































   965....970.........980........ .990.........1000...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions