Return to main results Retrieve Phyre Job Id

Job DescriptionP64536
Confidence6.72%DateThu Jan 5 12:09:16 GMT 2012
Rank26Aligned Residues22
% Identity18%Templated1bwva1
SCOP infoTIM beta/alpha-barrel RuBisCo, C-terminal domain RuBisCo, large subunit, C-terminal domain
Resolution2.40

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.. .......40.
Predicted Secondary structure  .............




Query SS confidence 












. . . . . . . . . . . . .








Query Sequence  FREAWKGWRAGAI. . . . . . . . . . . . . DKRVKNAPE
Query Conservation 


  

 


 
.............

 

 
 
Alig confidence 












.............








Template Conservation   





   
          
   
 
 

   
Template Sequence  NRVALEAMILARNENRDYLTEGPEILREAAKTCGA
Template Known Secondary structure  TT


Template Predicted Secondary structure 












Template SS confidence 


































   420.........430.........440.........450....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions