Return to main results Retrieve Phyre Job Id

Job DescriptionP64536
Confidence3.23%DateThu Jan 5 12:09:16 GMT 2012
Rank70Aligned Residues22
% Identity32%Templatec1rldB_
PDB info PDB header:lyase(carbon-carbon)Chain: B: PDB Molecule:ribulose 1,5 bisphosphate carboxylase/oxygenase (large PDBTitle: solid-state phase transition in the crystal structure of ribulose 1,5-2 biphosphate carboxylase(slash)oxygenase
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.. .......40.
Predicted Secondary structure  .............




Query SS confidence 












. . . . . . . . . . . . .








Query Sequence  FREAWKGWRAGAI. . . . . . . . . . . . . DKRVKNAPE
Query Conservation 


  

 


 
.............

 

 
 
Alig confidence 












.............








Template Conservation   





   
     
        
 
 

   
Template Sequence  NRVALEACVKARNEGRDLAQEGNEIIREACKWSPE
Template Known Secondary structure  TT


Template Predicted Secondary structure 












Template SS confidence 


































   420.........430.........440.........450....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions