Return to main results Retrieve Phyre Job Id

Job DescriptionP75712
Confidence9.39%DateThu Jan 5 12:13:21 GMT 2012
Rank17Aligned Residues22
% Identity32%Templatec1r8jB_
PDB info PDB header:circadian clock proteinChain: B: PDB Molecule:kaia; PDBTitle: crystal structure of circadian clock protein kaia from2 synechococcus elongatus
Resolution2.03 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10... ... ...20......
Predicted Secondary structure 


.......


..






Query SS confidence 








. . . . . . .


. .









Query Sequence  RKLFQQRGY. . . . . . . SED. . LLPKTQSQRT
Query Conservation           .......
  ..
 


   
 
Alig confidence 








.......


..









Template Conservation   
















  
   
   
 
Template Sequence  QRLQERLGYLGVYYKRDPDRFLRNLPAYESQ
Template Known Secondary structure 









GGGSGGG

Template Predicted Secondary structure 






Template SS confidence 






























   158.160.........170.........180........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions