Return to main results Retrieve Phyre Job Id

Job DescriptionP27126
Confidence2.71%DateThu Jan 5 11:43:13 GMT 2012
Rank63Aligned Residues24
% Identity25%Templatec3i0zB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:putative tagatose-6-phosphate ketose/aldose isomerase; PDBTitle: crystal structure of putative putative tagatose-6-phosphate2 ketose/aldose isomerase (np_344614.1) from streptococcus pneumoniae3 tigr4 at 1.70 a resolution
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   230.........240...... ...250...
Predicted Secondary structure 







........


Query SS confidence 
















. . . . . . . .






Query Sequence  QSGWTLRILEALFFNKK. . . . . . . . LITNNIN
Query Conservation 
 


 
  


   

........




  
Alig confidence 
















........






Template Conservation 




 


 

  

  
     
 

    
Template Sequence  RSGNSPESLATVDLAKSLVDELYQVTITCAAD
Template Known Secondary structure  SSS


SSS
TT
Template Predicted Secondary structure 











Template SS confidence 































   117..120.........130.........140........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions