Return to main results Retrieve Phyre Job Id

Job DescriptionP27126
Confidence3.28%DateThu Jan 5 11:43:13 GMT 2012
Rank53Aligned Residues24
% Identity38%Templatec3c3jA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:putative tagatose-6-phosphate ketose/aldose isomerase; PDBTitle: crystal structure of tagatose-6-phosphate ketose/aldose isomerase from2 escherichia coli
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   230.........240. ...... ..250...
Predicted Secondary structure 




....


....


Query SS confidence 











. . . .





. . . .





Query Sequence  QSGWTLRILEAL. . . . FFNKKL. . . . ITNNIN
Query Conservation 
 


 
  


....   


....



  
Alig confidence 











....





....





Template Conservation 


 
 


 

  
   
    

 

    
Template Sequence  RSGNSPESVAAVELANQFVPECYHLPITCNEA
Template Known Secondary structure  SSS


SSS
TT
Template Predicted Secondary structure 













Template SS confidence 































   112.......120.........130.........140...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions