Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEY3
Confidence17.40%DateThu Jan 5 11:24:37 GMT 2012
Rank46Aligned Residues24
% Identity42%Templated2fzpa1
SCOP infoNRDP1 C-terminal domain-like NRDP1 C-terminal domain-like USP8 interacting domain
Resolution1.87

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40..
Predicted Secondary structure 












Query SS confidence 
































Query Sequence  IMQRLRDPENGCPWDKEQTFATIAPYTLEETYE
Query Conservation 

  

 
  




  

  

   



 

Alig confidence 






..



.......












Template Conservation 

 



..



.......

 

 


 


Template Sequence  IKRSLVE. . SGCP. . . . . . . ASIVNELIENAHE
Template Known Secondary structure  ..TT

.......TTSG
Template Predicted Secondary structure  ..


.......
Template SS confidence 
































   229230..... .... 240.........250..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions