Return to main results Retrieve Phyre Job Id

Job DescriptionP56257
Confidence1.21%DateThu Jan 5 12:06:19 GMT 2012
Rank63Aligned Residues27
% Identity22%Templatec1qoyA_
PDB info PDB header:toxinChain: A: PDB Molecule:hemolysin e; PDBTitle: e.coli hemolysin e (hlye, clya, shea)
Resolution2.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.....
Predicted Secondary structure 















Query SS confidence 



































Query Sequence  LMPAYRGEAGQQVNIKIMEYSERNVRQLASNEQEEY
Query Conservation 



































Alig confidence 













.........












Template Conservation   
 

 
 

  

......... 

 


 


 
Template Sequence  FKQEYSQAASVLVG. . . . . . . . . DIKTLLMDSQDKY
Template Known Secondary structure  TGGGS
.........
Template Predicted Secondary structure 



.........
Template SS confidence 



































   50.........60... ......70......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions