Return to main results Retrieve Phyre Job Id

Job DescriptionP24171
Confidence91.95%DateThu Jan 5 11:40:46 GMT 2012
Rank45Aligned Residues27
% Identity41%Templatec3dtkA_
PDB info PDB header:gene regulationChain: A: PDB Molecule:irre protein; PDBTitle: crystal structure of the irre protein, a central regulator2 of dna damage repair in deinococcaceae
Resolution3.24 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   440.........450.........460.........470......
Predicted Secondary structure 
















Query SS confidence 




































Query Sequence  HPVIYNVCNYQKPAAGEPALLLWDDVITLFHEFGHTL
Query Conservation   
   
  

         

   

 

 





 
Alig confidence 











..........














Template Conservation     
 

     .......... 
 









  
Template Sequence  HHVILINSQVRP. . . . . . . . . . ERQRFTLAHEISHAL
Template Known Secondary structure  TTSSS
..........
Template Predicted Secondary structure 






..........
Template SS confidence 




































   62.......70... ......80........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions