Return to main results Retrieve Phyre Job Id

Job DescriptionP24171
Confidence81.99%DateThu Jan 5 11:40:46 GMT 2012
Rank88Aligned Residues26
% Identity19%Templatec2e3xA_
PDB info PDB header:hydrolase, blood clotting, toxinChain: A: PDB Molecule:coagulation factor x-activating enzyme heavy chain; PDBTitle: crystal structure of russell's viper venom metalloproteinase
Resolution2.91 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   442.......450.........460.........470......
Predicted Secondary structure 














Query SS confidence 


































Query Sequence  VIYNVCNYQKPAAGEPALLLWDDVITLFHEFGHTL
Query Conservation     
  

         

   

 

 





 
Alig confidence 









.........















Template Conservation            .........    
   





 
Template Sequence  VGIVQEQGNR. . . . . . . . . NFKTAVIMAHELSHNL
Template Known Secondary structure 

TT
.........TT
Template Predicted Secondary structure 





.........



Template SS confidence 


































   126...130..... ....140.........150.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions