Return to main results Retrieve Phyre Job Id

Job DescriptionP24177
Confidence14.09%DateWed Jan 25 15:20:44 GMT 2012
Rank72Aligned Residues43
% Identity30%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   443......450.........460.........470.........480.........490.........500.
Predicted Secondary structure 







Query SS confidence 


























































Query Sequence  VGIAMVLSAVFVPMAFFGGTTGAIYRQFSITIVAAMVLSVLVAMILTPALCATLLKPLK
Query Conservation    





 

 

          
   

     

 


  

  


         
Alig confidence 







..














..............



















Template Conservation   


 
 
..




 







 ..............    
          




Template Sequence  VLTIIATI. . FMPLTFIAGIYGYPV. . . . . . . . . . . . . . VLAVMGVIAVIMVVYFKKKK
Template Known Secondary structure  ..TTS


..............TTTTS

Template Predicted Secondary structure  ................

Template SS confidence 


























































   293......300 .........310..... ....320.........330.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions