Return to main results Retrieve Phyre Job Id

Job DescriptionP38051
Confidence3.28%DateThu Jan 5 11:57:52 GMT 2012
Rank88Aligned Residues31
% Identity32%Templatec3navB_
PDB info PDB header:lyaseChain: B: PDB Molecule:tryptophan synthase alpha chain; PDBTitle: crystal structure of an alpha subunit of tryptophan synthase from2 vibrio cholerae o1 biovar el tor str. n16961
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   400.. ...... .410.........420.........430
Predicted Secondary structure 
.


...........


Query SS confidence 


.





. . . . . . . . . . .





















Query Sequence  AGA. GIVRGS. . . . . . . . . . . DPEQEWQEIDNKAAGLRTLLQM
Query Conservation 


.


  
...........

  
  

  
   

  
  
Alig confidence 


.





...........





















Template Conservation   











  
             
      

 
 
 
Template Sequence  AGAAGAISGSAVVKIIETHLDNPAKQLTELANFTQAMKKATKI
Template Known Secondary structure  TT
SSSTTT
TTB
Template Predicted Secondary structure 










Template SS confidence 










































   226...230.........240.........250.........260........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions