Return to main results Retrieve Phyre Job Id

Job DescriptionP33227
Confidence1.95%DateThu Jan 5 11:51:26 GMT 2012
Rank69Aligned Residues16
% Identity56%Templatec3llkA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:sulfhydryl oxidase 1; PDBTitle: sulfhydryl oxidase fragment of human qsox1
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40.........50......
Predicted Secondary structure 




















Query SS confidence 

































Query Sequence  PTGWLKCNGAAFSAEEYPELAKAYPTNKLPDLRG
Query Conservation 
 

  


       
  
   



 





Alig confidence 










..................




Template Conservation     
  
 

 ..................
  

Template Sequence  KVNWIGCQGSE. . . . . . . . . . . . . . . . . . PHFRG
Template Known Secondary structure  S


STT

SS..................TTSSS
Template Predicted Secondary structure 







..................




Template SS confidence 

































   387..390....... ..400..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions