Return to main results Retrieve Phyre Job Id

Job DescriptionP68739
Confidence13.43%DateThu Jan 5 12:11:10 GMT 2012
Rank45Aligned Residues27
% Identity26%Templatec1fokA_
PDB info PDB header:hydrolase/dnaChain: A: PDB Molecule:protein (foki restriction endonucleas); PDBTitle: structure of restriction endonuclease foki bound to dna
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   190.........200.........210.........220..
Predicted Secondary structure 









Query SS confidence 
































Query Sequence  QRCMKGYRLPEPTRWADAVASERPAFVRYTANQ
Query Conservation        





 
 

  

     

     
Alig confidence 






..











....







Template Conservation 



 

..



 




 
....
   
  
Template Sequence  KAYSGGY. . NLPIGQADEMQR. . . . YVEENQTR
Template Known Secondary structure 

TT

..


....TTS
Template Predicted Secondary structure 






..


....

Template SS confidence 
































   469470..... ....480....... ..490.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions