Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE14
Confidence8.15%DateThu Jan 5 11:22:14 GMT 2012
Rank31Aligned Residues26
% Identity23%Templated1hynp_
SCOP infoPhoshotransferase/anion transport protein Phoshotransferase/anion transport protein Anion transport protein, cytoplasmic domain
Resolution2.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   149150.........160.........170.........180.........190...
Predicted Secondary structure 







Query SS confidence 












































Query Sequence  FWLIVGGTWGPVTLMGYAFLRAWQYWLARYQTPHHRLQSGIDAVL
Query Conservation 


 
 
  

 

 



   
              
  


  
Alig confidence 









...................















Template Conservation 







  ...................    











Template Sequence  FLFVLLGPEA. . . . . . . . . . . . . . . . . . . PHIDYTQLGRAAATLM
Template Known Secondary structure 


...................TT

Template Predicted Secondary structure 



...................



Template SS confidence 












































   264.....270... ......280.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions