Return to main results Retrieve Phyre Job Id

Job DescriptionP77307
Confidence2.50%DateThu Jan 5 12:27:34 GMT 2012
Rank98Aligned Residues26
% Identity27%Templatec2klzA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:ataxin-3; PDBTitle: solution structure of the tandem uim domain of ataxin-3 complexed with2 ubiquitin
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   139140.........150.........160.........170.........180..
Predicted Secondary structure 




Query SS confidence 











































Query Sequence  GLCYNNLGQRVISEQQQIQEKLSLGATPKQASAILIRDSIRAAL
Query Conservation 


  

   
      

  





   
     
 

  

Alig confidence 

















..................







Template Conservation 





 
   






..................







Template Sequence  ALALSRQEIDMEDEEADL. . . . . . . . . . . . . . . . . . RRAIQLSM
Template Known Secondary structure 

SSS..................
Template Predicted Secondary structure  ..................
Template SS confidence 











































   13......20.........30 ........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions