Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADL3
Confidence8.25%DateThu Jan 5 11:21:17 GMT 2012
Rank86Aligned Residues27
% Identity19%Templatec3hdlA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:royal palm tree peroxidase; PDBTitle: crystal structure of highly glycosylated peroxidase from royal palm2 tree
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   62....... 70...... ...80........
Predicted Secondary structure 



..............



Query SS confidence 







. . . . . . . . . . . . .






.











Query Sequence  HRPDESHL. . . . . . . . . . . . . QNAAQVL. LIWQIVIVDGSE
Query Conservation      
 

............. 


 

.

 
  



 
Alig confidence 







.............






.











Template Conservation   

  
 

   
      
   
  



 





 


Template Sequence  SCPTAESLVQQAVAAAFANNSGIAPGLIRMHFHDCFVRGCD
Template Known Secondary structure  T
TT
TTTTTSSS
Template Predicted Secondary structure 











Template SS confidence 








































   10.........20.........30.........40.........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions