Return to main results Retrieve Phyre Job Id

Job DescriptionP40711
Confidence3.95%DateThu Jan 5 12:01:14 GMT 2012
Rank94Aligned Residues32
% Identity34%Templatec3dm5A_
PDB info PDB header:rna binding protein, transport proteinChain: A: PDB Molecule:signal recognition 54 kda protein; PDBTitle: structures of srp54 and srp19, the two proteins assembling2 the ribonucleic core of the signal recognition particle3 from the archaeon pyrococcus furiosus.
Resolution2.51 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60........ .70........
Predicted Secondary structure 























..


Query SS confidence 










































. .









Query Sequence  GGQHVNKTSTAIHLRFDIRASSLPEYYKERLLAASHHLISSDG. . VIVIKAQEYR
Query Conservation 






  


 

       

      
      

   
.. 


     
Alig confidence 











.....................









..









Template Conservation 
  
 




 
.....................


      
 

 

 


 
Template Sequence  GIQGSGKTTTVA. . . . . . . . . . . . . . . . . . . . . KLARYFQKRGYKVGVVCSDTWR
Template Known Secondary structure 

TTSS.....................TTT




SS
Template Predicted Secondary structure 





.....................








Template SS confidence 






















































   107..110........ .120.........130.........140
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions