Return to main results Retrieve Phyre Job Id

Job DescriptionP40711
Confidence16.55%DateThu Jan 5 12:01:14 GMT 2012
Rank31Aligned Residues53
% Identity13%Templatec2jzxA_
PDB info PDB header:rna binding proteinChain: A: PDB Molecule:poly(rc)-binding protein 2; PDBTitle: pcbp2 kh1-kh2 domains
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30... ......40.........50.........60.........70.........80.........90.......
Predicted Secondary structure 









..



















Query SS confidence 









. .































































Query Sequence  GAGGQHVNKT. . STAIHLRFDIRASSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKE
Query Conservation 








 .. 


 

       

      
      

   
 


     


  

  
  

   
  
Alig confidence 









..











..................














...















Template Conservation 
  
  

 
   

  
 
    ..................     

 
 
 
  ...  
  
   
   
 
Template Sequence  GKGGCKIKEIRESTGAQVQVAGDM. . . . . . . . . . . . . . . . . . LPNSTERAITIAGIP. . . QSIIECVKQICVVMLE
Template Known Secondary structure 
GGGSS





..................STT


...
Template Predicted Secondary structure 










..................






...
Template SS confidence 











































































   114.....120.........130....... ..140.........150.. .......160........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions