Return to main results Retrieve Phyre Job Id

Job DescriptionP40711
Confidence13.05%DateThu Jan 5 12:01:14 GMT 2012
Rank40Aligned Residues46
% Identity15%Templatec2e3uA_
PDB info PDB header:rna binding proteinChain: A: PDB Molecule:hypothetical protein ph1566; PDBTitle: crystal structure analysis of dim2p from pyrococcus horikoshii ot3
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.........60.........70.........80.........90......
Predicted Secondary structure 





























Query SS confidence 








































































Query Sequence  GAGGQHVNKTSTAIHLRFDIRASSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIK
Query Conservation 








  


 

       

      
      

   
 


     


  

  
  

   
 
Alig confidence 




















......................








.....















Template Conservation 

 
  

 
   

  
 
 ......................   
 
 
 .....   
  
   
   
 
Template Sequence  GRKGRTRQIIEEMSGASVSVY. . . . . . . . . . . . . . . . . . . . . . GKTVAIIGN. . . . . PIQIEIAKTAIEKLAR
Template Known Secondary structure 
GGG

......................TT
.....T
Template Predicted Secondary structure 





......................


.....
Template SS confidence 








































































   145....150.........160..... ....170.... .....180.........190
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions