Return to main results Retrieve Phyre Job Id

Job DescriptionP40711
Confidence4.72%DateThu Jan 5 12:01:14 GMT 2012
Rank82Aligned Residues51
% Identity18%Templatec1tuaA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein ape0754; PDBTitle: 1.5 a crystal structure of a protein of unknown function2 ape0754 from aeropyrum pernix
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.... .....40.........50.........60.........70.........80.........90......
Predicted Secondary structure 










..


















Query SS confidence 










. .





























































Query Sequence  GAGGQHVNKTS. . TAIHLRFDIRASSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIK
Query Conservation 








  ..


 

       

      
      

   
 


     


  

  
  

   
 
Alig confidence 










..









......................





























Template Conservation 

 
  

 
   
   
 
   ......................          
 
    
  
   
     
Template Sequence  GPRGEVKAEIMRRTGTVITVDTE. . . . . . . . . . . . . . . . . . . . . . NSMVIVEPEAEGIPPVNLMKAAEVVKAISL
Template Known Secondary structure 
GGGTTT......................TTSSTTS
Template Predicted Secondary structure 







......................










Template SS confidence 










































































   1920.........30.........40. ........50.........60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions