Return to main results Retrieve Phyre Job Id

Job DescriptionP33349
Confidence26.16%DateThu Jan 5 11:51:51 GMT 2012
Rank27Aligned Residues38
% Identity16%Templatec1n60D_
PDB info PDB header:oxidoreductaseChain: D: PDB Molecule:carbon monoxide dehydrogenase small chain; PDBTitle: crystal structure of the cu,mo-co dehydrogenase (codh); cyanide-2 inactivated form
Resolution1.19 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   304.....310.........320.........330.........340.........350......
Predicted Secondary structure 
























Query SS confidence 




















































Query Sequence  AQLRGHTLPLRTDWLDAIAGSLIKEALNAPLPWSYRGVIHPDTDPILLTLIDT
Query Conservation 
 


   

  

 

  
 
 
            
   
            
Alig confidence 






















...............














Template Conservation   

     
   

  

 



...............




  
  

  
Template Sequence  RLLQENPSPTEAEIRFGIGGNLC. . . . . . . . . . . . . . . RCTGYQNIVKAIQYA
Template Known Secondary structure 
SS

TTT


...............SSSTT
Template Predicted Secondary structure 









...............




Template SS confidence 




















































   115....120.........130....... ..140.........150..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions