Return to main results Retrieve Phyre Job Id

Job DescriptionP77169
Confidence10.04%DateThu Jan 5 12:25:53 GMT 2012
Rank28Aligned Residues47
% Identity13%Templated1tf5a2
SCOP infoHelical scaffold and wing domains of SecA Helical scaffold and wing domains of SecA Helical scaffold and wing domains of SecA
Resolution2.18

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50.........60.........70.........80.........90...
Predicted Secondary structure 




























Query SS confidence 








































































Query Sequence  DGEADRLAKAWLAEYTPQIKSLKDERKEAYRQIVEMSTEPQDVDLVRPANKFEMTRVREGEKEADLPVWKHHL
Query Conservation 
  
     

   
   
  
    

 
  

  
 

   
 
 
    


      
         

Alig confidence 

































...................






.......





Template Conservation        
       
  
            

 
................... 
  

 ....... 
 


Template Sequence  DEMLELIMDRIITKYNEKEEQFGKEQMREFEKVI. . . . . . . . . . . . . . . . . . . VLRAVDS. . . . . . . KWMDHI
Template Known Secondary structure  S
SS..........................
Template Predicted Secondary structure 

..........................
Template SS confidence 








































































   682.......690.........700.........710..... ....720.. ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions