Return to main results Retrieve Phyre Job Id

Job DescriptionP27298
Confidence83.46%DateWed Jan 25 15:20:46 GMT 2012
Rank87Aligned Residues31
% Identity29%Templatec3k7nA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:k-like; PDBTitle: structures of two elapid snake venom metalloproteases with2 distinct activities highlight the disulfide patterns in the3 d domain of adamalysin family proteins
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   436...440.........450.........460.........470.....
Predicted Secondary structure 



















Query SS confidence 







































Query Sequence  SLQKPVAYLTCNFNRPVNGKPALFTHDEVITLFHEFGHGL
Query Conservation    
 
   
  

          
   

 

 





 
Alig confidence 














.........















Template Conservation         
       .........       






  
Template Sequence  KTNESVAIVQDYNRR. . . . . . . . . ISLVASTITHELGHNL
Template Known Secondary structure 
TTT



S
.........T
Template Predicted Secondary structure 









.........

Template SS confidence 







































   317..320.........330. ........340.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions