Return to main results Retrieve Phyre Job Id

Job DescriptionP25536
Confidence8.59%DateThu Jan 5 11:42:03 GMT 2012
Rank68Aligned Residues44
% Identity25%Templatec2cveA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein ttha1053; PDBTitle: crystal structure of a conserved hypothetical protein tt1547 from2 thermus thermophilus hb8
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   84.....90.........100.........110.........120.........130.........140........
Predicted Secondary structure 

















Query SS confidence 
































































Query Sequence  RDAEHAAQMLRKLSGQTHQVMTAVALADSQHILDCLVVTDVTFRTLTDEDIAGYVASDEPLDKAG
Query Conservation     


   
  


  
 
 
 
 
            
 
 
  
    
  

       


Alig confidence 













.














....................














Template Conservation      

   
    .   
 
 
 

  
 ....................    





 



Template Sequence  ASEEEALAFLAENR. EPEATHNGHAYKIGL. . . . . . . . . . . . . . . . . . . . LYRFSDDGEPSGTAG
Template Known Secondary structure  SS
.
TTSSTT....................
TTSSTTSS
Template Predicted Secondary structure 



.






....................














Template SS confidence 
































































   28.30.........40. ........50...... ...60.........70.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions