Return to main results Retrieve Phyre Job Id

Job DescriptionP75916
Confidence1.25%DateWed Jan 25 15:21:04 GMT 2012
Rank85Aligned Residues26
% Identity50%Templatec2axtc_
PDB info PDB header:electron transportChain: C: PDB Molecule:photosystem ii cp43 protein; PDBTitle: crystal structure of photosystem ii from thermosynechococcus elongatus
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20 .........30......
Predicted Secondary structure  ...................
Query SS confidence 









. . . . . . . . . . . . . . . . . . .















Query Sequence  TGILSGIWGW. . . . . . . . . . . . . . . . . . . VAVSLGLLSWAGFLGC
Query Conservation   


 


  ...................

   

  
 

 
 
Alig confidence 









...................















Template Conservation 
 
 


 

   
     
 
  
 

 

 




  





Template Sequence  ICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIAT
Template Known Secondary structure  T



TTS


Template Predicted Secondary structure 






Template SS confidence 












































   5243......5250.........5260.........5270.........5280.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions