Phyre Home Retrieve Phyre Job Id
Emaill.a.kelley@imperial.ac.uk
DescriptionP75916
DateWed Jan 25 15:21:04 GMT 2012
Unique Job ID7f8ee83b8bc197ab

Summary 

Top model
Image coloured by rainbow N → C terminus
Model (left) based on template c3qnqD_
Top template information
PDB header:membrane protein, transport protein
Chain: D: PDB Molecule:pts system, cellobiose-specific iic component;
PDBTitle: crystal structure of the transporter chbc, the iic component from the2 n,n'-diacetylchitobiose-specific phosphotransferase system
Confidence and coverage
Confidence: 43.5% Coverage: 52%
84 residues ( 52% of your sequence) have been modelled with 43.5% confidence by the single highest scoring template.
You may wish to submit your sequence to Phyrealarm. This will automatically scan your sequence every week for new potential templates as they appear in the Phyre2 library.
Please note: You must be registered and logged in to use Phyrealarm.
3D viewing
Interactive 3D view in Jmol

Sequence analysis 

Secondary structure and disorder prediction 

   1........10.........20.........30.........40.........50.........60
Sequence  MNILLSIAITTGILSGIWGWVAVSLGLLSWAGFLGCTAYFACPQGGLKGLAISAATLLSG
Secondary structure 





SS confidence 



























































Disorder  ??

























































Disorder confidence 



























































 
   .........70.........80.........90.........100.........110.........120
Sequence  VVWAMVIIYGSALAPHLEILGYVITGIVAFLMCIQAKQLLLSFVPGTFIGACATFAGQGD
Secondary structure 










SS confidence 



























































Disorder 











???












































Disorder confidence 



























































 
   .........130.........140.........150.........160...
Sequence  WKLVLPSLALGLIFGYAMKNSGLWLAARSAKTAHREQEIKNKA
Secondary structure 




SS confidence 










































Disorder 





























?????




???
Disorder confidence 










































 

Confidence Key
High(9)                    Low (0)
?Disordered
Alpha helix
Beta strand

Domain analysis 

Hover over an aligned region to see model and summary info

Please note, only up to the top 20 hits are modelled to reduce computer load

RankAligned region

PDB 3qnq chain D

3D model

Region: 78 - 161
Aligned: 84
Modelled: 84
Confidence: 43.5%
Identity: 8%
PDB header:membrane protein, transport protein
Chain: D: PDB Molecule:pts system, cellobiose-specific iic component;
PDBTitle: crystal structure of the transporter chbc, the iic component from the2 n,n'-diacetylchitobiose-specific phosphotransferase system

Phyre2

PDB 2wvm chain A

3D model

Region: 102 - 118
Aligned: 17
Modelled: 17
Confidence: 14.4%
Identity: 18%
PDB header:transferase
Chain: A: PDB Molecule:mannosyl-3-phosphoglycerate synthase;
PDBTitle: h309a mutant of mannosyl-3-phosphoglycerate synthase from2 thermus thermophilus hb27 in complex with3 gdp-alpha-d-mannose and mg(ii)

Phyre2

PDB 2zu8 chain A

3D model

Region: 102 - 118
Aligned: 17
Modelled: 17
Confidence: 13.1%
Identity: 18%
PDB header:transferase
Chain: A: PDB Molecule:mannosyl-3-phosphoglycerate synthase;
PDBTitle: crystal structure of mannosyl-3-phosphoglycerate synthase2 from pyrococcus horikoshii

Phyre2

PDB 2nww chain A domain 1

3D model

Region: 100 - 161
Aligned: 59
Modelled: 62
Confidence: 9.1%
Identity: 15%
Fold: Proton glutamate symport protein
Superfamily: Proton glutamate symport protein
Family: Proton glutamate symport protein

Phyre2
1

c3qnqD_
2

c2wvmA_
3

c2zu8A_
4

d2nwwa1



Detailed template information 

#
Template Alignment Coverage3D Model Confidence
% i.d. Template Information
1c3qnqD_



43.5 8 PDB header:membrane protein, transport protein
Chain: D: PDB Molecule:pts system, cellobiose-specific iic component;
PDBTitle: crystal structure of the transporter chbc, the iic component from the2 n,n'-diacetylchitobiose-specific phosphotransferase system
2c2wvmA_



14.4 18 PDB header:transferase
Chain: A: PDB Molecule:mannosyl-3-phosphoglycerate synthase;
PDBTitle: h309a mutant of mannosyl-3-phosphoglycerate synthase from2 thermus thermophilus hb27 in complex with3 gdp-alpha-d-mannose and mg(ii)
3c2zu8A_



13.1 18 PDB header:transferase
Chain: A: PDB Molecule:mannosyl-3-phosphoglycerate synthase;
PDBTitle: crystal structure of mannosyl-3-phosphoglycerate synthase2 from pyrococcus horikoshii
4d2nwwa1



9.1 15 Fold:Proton glutamate symport protein
Superfamily:Proton glutamate symport protein
Family:Proton glutamate symport protein

Binding site prediction 

Due to computational demand, binding site predictions are not run for batch jobs

If you want to predict binding sites, please manually submit your model of choice to 3DLigandSite



Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
If you use the binding site predictions from 3DLigandSite, please also cite:
3DLigandSite: predicting ligand-binding sites using similar structures.
Wass MN, Kelley LA and Sternberg MJ Nucleic Acids Research 38, W469-73 (2010) [PubMed]
 
© Structural Bioinformatics Group
Imperial College London
Lawrence Kelley, Benjamin Jefferys
Disclaimer
Terms and Conditions
Component software
Template detection: HHpred 1.51
Secondary structure prediction: Psi-pred 2.5
Disorder prediction: Disopred 2.4
Transmembrane prediction: Memsat_SVM
Multi-template modelling and ab initio: Poing 1.0