Return to main results Retrieve Phyre Job Id

Job DescriptionP75969
Confidence4.76%DateThu Jan 5 12:16:36 GMT 2012
Rank74Aligned Residues35
% Identity9%Templatec3qp5C_
PDB info PDB header:transcriptionChain: C: PDB Molecule:cvir transcriptional regulator; PDBTitle: crystal structure of cvir bound to antagonist chlorolactone (cl)
Resolution3.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   301........310.........320.........330.........340......
Predicted Secondary structure 




















Query SS confidence 













































Query Sequence  VKANTLTMNFSKARDLARIDWGEGSPATFHEQRSLSERLYKEQGLD
Query Conservation                  


        
 
 



 

 
   
  
Alig confidence 




















...........













Template Conservation 

  

  

  
  



 
...........
 



 
 



 
Template Sequence  ISERTVKFHVANVIRKLNANN. . . . . . . . . . . RTHAIVLGMHLAMP
Template Known Secondary structure 

T
SS...........T

Template Predicted Secondary structure 






...........



Template SS confidence 













































   224.....230.........240.... .....250........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions