Return to main results Retrieve Phyre Job Id

Job DescriptionP45581
Confidence6.61%DateThu Jan 5 12:03:27 GMT 2012
Rank58Aligned Residues38
% Identity29%Templatec2q9rA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:protein of unknown function; PDBTitle: crystal structure of a duf416 family protein (sbal_3149) from2 shewanella baltica os155 at 1.91 a resolution
Resolution1.91 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50.........60.........70.........80.........90.........100
Predicted Secondary structure 
























Query SS confidence 

























































Query Sequence  LQEELCSVVEASGASLEKGRHDQLLTALRALLLSRKNPFGDIKSDGTVQTALENLGLG
Query Conservation 




  

  


 

     

  

  
                
  
  




Alig confidence 











.....














...............










Template Conservation   
  

  
   .....       

 

   ...............   






 
Template Sequence  LQNSLLEIIEEN. . . . . PKITAELVKGLRKDI. . . . . . . . . . . . . . . IETGVSNIGIS
Template Known Secondary structure  TS.....SS

...............


TTS

Template Predicted Secondary structure 
.....



...............





Template SS confidence 

























































   160.........170. ........180...... ...190.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions